PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna05167.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 384aa    MW: 42796.7 Da    PI: 5.2194
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna05167.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rgrWT+eEde+l ++++++G g+W++ ++  g+ R++k+c++rw +yl
  mrna05167.1-v1.0-hybrid 14 RGRWTAEEDEILTNYIQLHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                             8*******************************99************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T+eE+e +v++++ lG++ W++Ia+ ++ gRt++++k++w+++l
  mrna05167.1-v1.0-hybrid  67 RGNITQEEEETIVKLHTALGNR-WSLIAAQLP-GRTDNEIKNYWNSHL 112
                              7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.655961IPR017930Myb domain
SuperFamilySSF466891.03E-2811108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001674.48E-101661No hitNo description
PROSITE profilePS5129425.09962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2565116IPR009057Homeodomain-like
SMARTSM007173.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001672.88E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEILTNYIQ LHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRTDLRRGNI TQEEEETIVK LHTALGNRWS LIAAQLPGRT DNEIKNYWNS HLSRKIYTFT  120
KLMGNECLIP TMINNVSKTA NAKSKRKGRT SRSTMKNKNK LNKNVTVPAS FPQVIKQAYV  180
NDVFESLTRE NAGQVETSPL MGSGCWSPKE KDGNEEEVET IRMLGGVQGS CLDITAAGMS  240
SSTTTAICVA NNGEKEALDP SECVDSDASV NHKPSGKTTA IGFKEQRGNE VMDFTDDHEV  300
TIKSDHQGIW SSNIEGSCDE MYAFSSPLNA AFDDHEWLDW DWLGGDGGGG LQCHNNEELD  360
LWDEGEVRIP WLWESGNVDD QRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285530.0FR828553.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb2 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295109.10.0PREDICTED: myb-related protein 330
TrEMBLF2QKX30.0F2QKX3_R
STRINGPOPTR_0010s15090.12e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.16e-76myb domain protein 111